Lineage for d1d9da1 (1d9d A:324-518)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2139920Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2139970Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 2139977Domain d1d9da1: 1d9d A:324-518 [33688]
    Other proteins in same PDB: d1d9da2
    protein/DNA complex; protein/RNA complex; complexed with mg, so4, zn

Details for d1d9da1

PDB Entry: 1d9d (more details), 2.18 Å

PDB Description: crystall structure of the complex of dna polymerase i klenow fragment with short dna fragment carrying 2'-0-aminopropyl-rna modifications 5'-d(tcg)-ap(auc)-3'
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1d9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9da1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOPe Domain Coordinates for d1d9da1:

Click to download the PDB-style file with coordinates for d1d9da1.
(The format of our PDB-style files is described here.)

Timeline for d1d9da1: