Lineage for d2kfna1 (2kfn A:324-518)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) 
Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) 
Domain d2kfna1: 2kfn A:324-518 [33682]
Other proteins in same PDB: d2kfna2
Details for d2kfna1
PDB Entry: 2kfn (more details), 2.03 Å
PDB Description: klenow fragment with bridging-sulfur substrate and manganese
SCOP Domain Sequences for d2kfna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kfna1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk
SCOP Domain Coordinates for d2kfna1:
Click to download the PDB-style file with coordinates for d2kfna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2kfna1:
- d2kfna1 first appeared (with stable ids) in SCOP 1.55
- d2kfna1 appears in SCOP 1.57
- d2kfna1 appears in SCOP 1.61
- d2kfna1 appears in the current release, SCOPe 2.08
View in 3D
