SCOPe 2.05: Domain d1c6vc_: 1c6v C:

Lineage for d1c6vc_ (1c6v C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Simian immunodeficiency virus [TaxId:11723] [53111] (1 PDB entry)

8. Domain d1c6vc_: 1c6v C: [33674]
   Other proteins in same PDB: d1c6vx_
   mutant

Details for d1c6vc_

PDB Entry: 1c6v, 3 Å

PDB Description: siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)

PDB Compounds: (C:) protein (siv integrase)

SCOPe Domain Sequences for d1c6vc_:

Sequence, based on SEQRES records:

>d1c6vc_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
ivlmavhcmnhkrrggigdmtpaerlinmitte

Sequence, based on observed residues (ATOM records):

>d1c6vc_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgveamnhhlknqidrireqansvetivlmavhcmn
hkrrggigdmtpaerlinmitte

Timeline for d1c6vc_:

• d1c6vc_ first appeared (with stable ids) in SCOP 1.55
  
• d1c6vc_ appears in SCOPe 2.04
  
• d1c6vc_ appears in SCOPe 2.06
  
• d1c6vc_ appears in the current release, SCOPe 2.08