Lineage for d5n7ia1 (5n7i A:439-549)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646973Superfamily h.4.17: occludin/ELL-like [144292] (2 families) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 2646980Family h.4.17.0: automated matches [329497] (1 protein)
    not a true family
  6. 2646981Protein automated matches [329498] (1 species)
    not a true protein
  7. 2646982Species Human (Homo sapiens) [TaxId:9606] [329499] (4 PDB entries)
  8. 2646989Domain d5n7ia1: 5n7i A:439-549 [336608]
    Other proteins in same PDB: d5n7ia2, d5n7ib2
    automated match to d1wpaa1

Details for d5n7ia1

PDB Entry: 5n7i (more details), 2.88 Å

PDB Description: crystal structure of the coiled-coil domain of human tricellulin
PDB Compounds: (A:) MARVEL domain-containing protein 2

SCOPe Domain Sequences for d5n7ia1:

Sequence, based on SEQRES records: (download)

>d5n7ia1 h.4.17.0 (A:439-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpdyvakypviqtddereaykavfqdqfseykelsaevqavlrkfdeldavmsrlphhse
srqeheaisriheefkkkkndptflekkercdylknklshikqriqeydkv

Sequence, based on observed residues (ATOM records): (download)

>d5n7ia1 h.4.17.0 (A:439-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpdyvakypviqtddereaykavfqdqfseykelsaevqavlrkfdeldavmheefkkkk
ndptflekkercdylknklshikqriqeydkv

SCOPe Domain Coordinates for d5n7ia1:

Click to download the PDB-style file with coordinates for d5n7ia1.
(The format of our PDB-style files is described here.)

Timeline for d5n7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n7ia2