SCOPe 2.08: Domain d5n7ia1: 5n7i A:439-549

Lineage for d5n7ia1 (5n7i A:439-549)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.17: occludin/ELL-like [144292] (2 families)
   antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)

5. Family h.4.17.0: automated matches [329497] (1 protein)
   not a true family

6. Protein automated matches [329498] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [329499] (4 PDB entries)

8. Domain d5n7ia1: 5n7i A:439-549 [336608]
   Other proteins in same PDB: d5n7ia2, d5n7ib2
   automated match to d1wpaa1

Details for d5n7ia1

PDB Entry: 5n7i, 2.88 Å

PDB Description: crystal structure of the coiled-coil domain of human tricellulin

PDB Compounds: (A:) MARVEL domain-containing protein 2

SCOPe Domain Sequences for d5n7ia1:

Sequence, based on SEQRES records:

>d5n7ia1 h.4.17.0 (A:439-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpdyvakypviqtddereaykavfqdqfseykelsaevqavlrkfdeldavmsrlphhse
srqeheaisriheefkkkkndptflekkercdylknklshikqriqeydkv

Sequence, based on observed residues (ATOM records):

>d5n7ia1 h.4.17.0 (A:439-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpdyvakypviqtddereaykavfqdqfseykelsaevqavlrkfdeldavmheefkkkk
ndptflekkercdylknklshikqriqeydkv

Timeline for d5n7ia1:

• d5n7ia1 first appeared in SCOPe 2.06
  
• d5n7ia1 appears in SCOPe 2.07