| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
| Domain d5mvva1: 5mvv A:6-147 [336600] Other proteins in same PDB: d5mvva2, d5mvvg_ automated match to d2btfa1 complexed with atp, ca, cd, scn |
PDB Entry: 5mvv (more details), 1.4 Å
SCOPe Domain Sequences for d5mvva1:
Sequence, based on SEQRES records: (download)
>d5mvva1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrgi
ltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf
esfnvpamyvaiqavlslyssg
>d5mvva1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpkdafvgdeaqtkrgiltlkypiehgi
vtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamyva
iqavlslyssg
Timeline for d5mvva1: