SCOPe 2.08: Domain d5mvva1: 5mvv A:6-147

Lineage for d5mvva1 (5mvv A:6-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries)

8. Domain d5mvva1: 5mvv A:6-147 [336600]
   Other proteins in same PDB: d5mvva2, d5mvvg_
   automated match to d2btfa1
   complexed with atp, ca, cd, scn

Details for d5mvva1

PDB Entry: 5mvv, 1.4 Å

PDB Description: crystal structure of plasmodium falciparum actin i- gelsolin segment 1 -cdatp complex

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d5mvva1:

Sequence, based on SEQRES records:

>d5mvva1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrgi
ltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf
esfnvpamyvaiqavlslyssg

Sequence, based on observed residues (ATOM records):

>d5mvva1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpkdafvgdeaqtkrgiltlkypiehgi
vtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamyva
iqavlslyssg

Timeline for d5mvva1:

• d5mvva1 first appeared in SCOPe 2.06
  
• d5mvva1 appears in SCOPe 2.07