Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries) |
Domain d5o7ac2: 5o7a C:246-440 [336536] Other proteins in same PDB: d5o7aa1, d5o7ab1, d5o7ac1, d5o7ad1, d5o7ae_, d5o7af1 automated match to d4i50a2 complexed with 9n5, acp, gdp, gtp, mg |
PDB Entry: 5o7a (more details), 2.5 Å
SCOPe Domain Sequences for d5o7ac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o7ac2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5o7ac2: