Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
Domain d5o7ac1: 5o7a C:1-245 [336535] Other proteins in same PDB: d5o7aa2, d5o7ab2, d5o7ac2, d5o7ad2, d5o7ae_, d5o7af1, d5o7af2 automated match to d4ihja1 complexed with 9n5, acp, gdp, gtp, mg |
PDB Entry: 5o7a (more details), 2.5 Å
SCOPe Domain Sequences for d5o7ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o7ac1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5o7ac1: