Class a: All alpha proteins [46456] (289 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (2 families) duplication: consists of four domains of the same fold |
Family a.65.1.1: Annexin [47875] (10 proteins) |
Protein automated matches [190368] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188886] (6 PDB entries) |
Domain d5lpua_: 5lpu A: [336528] Other proteins in same PDB: d5lpuc_, d5lpud1, d5lpud2 automated match to d1w7ba_ complexed with ca, gol |
PDB Entry: 5lpu (more details), 2.1 Å
SCOPe Domain Sequences for d5lpua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lpua_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
Timeline for d5lpua_:
View in 3D Domains from other chains: (mouse over for more information) d5lpub_, d5lpuc_, d5lpud1, d5lpud2 |