SCOPe 2.06: Domain d5x69d_: 5x69 D:

Lineage for d5x69d_ (5x69 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189245] (20 PDB entries)

8. Domain d5x69d_: 5x69 D: [336364]
   automated match to d2aaza_
   complexed with 7zc, ump

Details for d5x69d_

PDB Entry: 5x69, 2.69 Å

PDB Description: human thymidylate synthase with a fragment bound in the dimer interface

PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5x69d_:

Sequence; same for both SEQRES and ATOM records:

>d5x69d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikme

Timeline for d5x69d_:

• d5x69d_ is new in SCOPe 2.06-stable
  
• d5x69d_ appears in SCOPe 2.07
  
• d5x69d_ appears in the current release, SCOPe 2.08