SCOPe 2.06: Domain d5gmab1: 5gma B:1-323

Lineage for d5gmab1 (5gma B:1-323)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
   Pfam PF05448; AXE1

6. Protein automated matches [191114] (3 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [317746] (2 PDB entries)

8. Domain d5gmab1: 5gma B:1-323 [335586]
   Other proteins in same PDB: d5gmaa2, d5gmab2, d5gmac2, d5gmad2, d5gmae2, d5gmaf2
   automated match to d1l7aa_
   complexed with act

Details for d5gmab1

PDB Entry: 5gma, 2.1 Å

PDB Description: crystal structure of the p228a variant of thermotoga maritima acetyl esterase

PDB Compounds: (B:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5gmab1:

Sequence; same for both SEQRES and ATOM records:

>d5gmab1 c.69.1.25 (B:1-323) automated matches {Thermotoga maritima [TaxId: 243274]}
maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt
fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq
gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
nnhegggsfqaveqvkflkklfe

Timeline for d5gmab1:

• d5gmab1 is new in SCOPe 2.06-stable
  
• d5gmab1 appears in SCOPe 2.07
  
• d5gmab1 appears in the current release, SCOPe 2.08