SCOPe 2.06: Domain d5kb6a_: 5kb6 A:

Lineage for d5kb6a_ (5kb6 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein Adenosine kinase [53617] (3 species)

7. Species Mus musculus [TaxId:10090] [335051] (2 PDB entries)

8. Domain d5kb6a_: 5kb6 A: [335053]
   automated match to d4o1lb_
   complexed with act, adn, cl, pg4, so4

Details for d5kb6a_

PDB Entry: 5kb6, 1.2 Å

PDB Description: high-resolution structure of the adenosine kinase from mus musculus in complex with adenosine

PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d5kb6a_:

Sequence; same for both SEQRES and ATOM records:

>d5kb6a_ c.72.1.1 (A:) Adenosine kinase {Mus musculus [TaxId: 10090]}
alsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
ggstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgt
caacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkv
aryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdik
eiakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdaf
vggflsqlvsdkplteciraghyaasviirrtgctfpekpdfh

Timeline for d5kb6a_:

• d5kb6a_ is new in SCOPe 2.06-stable
  
• d5kb6a_ appears in SCOPe 2.07
  
• d5kb6a_ appears in the current release, SCOPe 2.08