Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (10 species) not a true protein |
Species Candida albicans [TaxId:5476] [334873] (4 PDB entries) |
Domain d5n15b1: 5n15 B:193-322 [334998] Other proteins in same PDB: d5n15b2, d5n15c2, d5n15d2 automated match to d5feaa_ complexed with epe, gol, iod |
PDB Entry: 5n15 (more details), 2.37 Å
SCOPe Domain Sequences for d5n15b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n15b1 a.29.2.0 (B:193-322) automated matches {Candida albicans [TaxId: 5476]} apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm vkvppkelpa
Timeline for d5n15b1:
View in 3D Domains from other chains: (mouse over for more information) d5n15c1, d5n15c2, d5n15d1, d5n15d2 |