Lineage for d1hlua1 (1hlu A:2-146)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137196Protein Actin [53073] (8 species)
  7. 2137207Species Cow (Bos taurus) [TaxId:9913] [53074] (3 PDB entries)
  8. 2137212Domain d1hlua1: 1hlu A:2-146 [33431]
    Other proteins in same PDB: d1hlup_
    complexed with atp, ca

Details for d1hlua1

PDB Entry: 1hlu (more details), 2.65 Å

PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
PDB Compounds: (A:) beta-actin

SCOPe Domain Sequences for d1hlua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlua1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d1hlua1:

Click to download the PDB-style file with coordinates for d1hlua1.
(The format of our PDB-style files is described here.)

Timeline for d1hlua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hlup_