Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (9 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [271524] (8 PDB entries) |
Domain d5n58b_: 5n58 B: [334273] automated match to d5a87b_ complexed with 93w, gol, zn |
PDB Entry: 5n58 (more details), 1.96 Å
SCOPe Domain Sequences for d5n58b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n58b_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} ipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakntaallae iekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaegneipthslegl sssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrtsagnvadadlae wptsveriqkhypeaevvipghglpggldllqhtanvvtah
Timeline for d5n58b_: