Lineage for d5n58b_ (5n58 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231411Species Klebsiella pneumoniae [TaxId:573] [271524] (8 PDB entries)
  8. 2231420Domain d5n58b_: 5n58 B: [334273]
    automated match to d5a87b_
    complexed with 93w, gol, zn

Details for d5n58b_

PDB Entry: 5n58 (more details), 1.96 Å

PDB Description: di-zinc vim-5 metallo-beta-lactamase in complex with (1-chloro-4- hydroxyisoquinoline-3-carbonyl)-d-tryptophan (compound 1)
PDB Compounds: (B:) Class B metallo-beta-lactamase

SCOPe Domain Sequences for d5n58b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n58b_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakntaallae
iekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaegneipthslegl
sssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrtsagnvadadlae
wptsveriqkhypeaevvipghglpggldllqhtanvvtah

SCOPe Domain Coordinates for d5n58b_:

Click to download the PDB-style file with coordinates for d5n58b_.
(The format of our PDB-style files is described here.)

Timeline for d5n58b_: