SCOPe 2.06: Domain d5n4ta_: 5n4t A:

Lineage for d5n4ta_ (5n4t A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)

8. Domain d5n4ta_: 5n4t A: [334224]
   automated match to d5acwa_
   complexed with bez, fmt, r59, zn

Details for d5n4ta_

PDB Entry: 5n4t, 1.16 Å

PDB Description: vim-2 metallo-beta-lactamase in complex with ((s)-3-mercapto-2- methylpropanoyl)-l-tryptophan (compound 4)

PDB Compounds: (A:) beta-lactamase vim-2

SCOPe Domain Sequences for d5n4ta_:

Sequence; same for both SEQRES and ATOM records:

>d5n4ta_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d5n4ta_:

• d5n4ta_ is new in SCOPe 2.06-stable
  
• d5n4ta_ appears in SCOPe 2.07
  
• d5n4ta_ appears in the current release, SCOPe 2.08