Lineage for d5j8gb_ (5j8g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963324Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (4 species)
  7. 2963325Species Enterobacter cloacae [TaxId:550] [55477] (6 PDB entries)
  8. 2963339Domain d5j8gb_: 5j8g B: [334076]
    automated match to d1neca_
    complexed with 4nb, fmn

Details for d5j8gb_

PDB Entry: 5j8g (more details), 1.9 Å

PDB Description: structure of nitroreductase from e. cloacae complexed with para- nitrobenzoic acid
PDB Compounds: (B:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d5j8gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j8gb_ d.90.1.1 (B:) Oxygen-insensitive NAD(P)H nitroreductase {Enterobacter cloacae [TaxId: 550]}
diisvalkrhstkafdaskkltaeeaekiktllqyspsstnsqpwhfivasteegkarva
ksaagtyvfnerkmldashvvvfcaktamddawlervvdqeeadgrfntpeakaanhkgr
tyfadmhrvdlkdddqwmakqvylnvgnfllgvgamgldavpiegfdaaildeefglkek
gftslvvvpvghhsvedfnatlpksrlplstivtec

SCOPe Domain Coordinates for d5j8gb_:

Click to download the PDB-style file with coordinates for d5j8gb_.
(The format of our PDB-style files is described here.)

Timeline for d5j8gb_: