Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5v4mg1: 5v4m G:4-81 [333942] Other proteins in same PDB: d5v4ma2, d5v4md2, d5v4mg2, d5v4mj2 automated match to d1fnga2 complexed with fuc, nag |
PDB Entry: 5v4m (more details), 2.1 Å
SCOPe Domain Sequences for d5v4mg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v4mg1 d.19.1.0 (G:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d5v4mg1: