Lineage for d5v4mg1 (5v4m G:4-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183687Domain d5v4mg1: 5v4m G:4-81 [333942]
    Other proteins in same PDB: d5v4ma2, d5v4md2, d5v4mg2, d5v4mj2
    automated match to d1fnga2
    complexed with fuc, nag

Details for d5v4mg1

PDB Entry: 5v4m (more details), 2.1 Å

PDB Description: structure of hla-dr15 with bound alpha3(135-145) peptide
PDB Compounds: (G:) hla-dra1

SCOPe Domain Sequences for d5v4mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4mg1 d.19.1.0 (G:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d5v4mg1:

Click to download the PDB-style file with coordinates for d5v4mg1.
(The format of our PDB-style files is described here.)

Timeline for d5v4mg1: