Lineage for d5nqbc2 (5nqb C:160-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2999102Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346390] (3 PDB entries)
  8. 2999105Domain d5nqbc2: 5nqb C:160-331 [333861]
    Other proteins in same PDB: d5nqba1, d5nqbb1, d5nqbc1, d5nqbd1
    automated match to d4i9ha2
    complexed with mli

Details for d5nqbc2

PDB Entry: 5nqb (more details), 1.58 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with malonate
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqbc2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5nqbc2:

Click to download the PDB-style file with coordinates for d5nqbc2.
(The format of our PDB-style files is described here.)

Timeline for d5nqbc2: