SCOPe 2.06: Domain d5wx4b1: 5wx4 B:5-241

Lineage for d5wx4b1 (5wx4 B:5-241)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)

8. Domain d5wx4b1: 5wx4 B:5-241 [333635]
   automated match to d3wd7a1

Details for d5wx4b1

PDB Entry: 5wx4, 2.2 Å

PDB Description: alkylquinolone synthase from evodia rutaecarpa

PDB Compounds: (B:) alkylquinolone synthase

SCOPe Domain Sequences for d5wx4b1:

Sequence; same for both SEQRES and ATOM records:

>d5wx4b1 c.95.1.0 (B:5-241) automated matches {Tetradium ruticarpum [TaxId: 354523]}
fsmekvkrildaqrtegpatvlaigtanpptcfyeadypdfyfrvtncedkpelkekfkr
isersavkkrylhvteeilkenpnmcsyrapsldarhailveevpklgkeaalkaikewg
qplskithlifsamsgvdipgadfrlmnllglepsvnrlmiytqgcymggaamrhakdia
ennagarvllvfcdlmdmyfhapqnrvdllygqavfgdgaaalivgadpdddcterp

Timeline for d5wx4b1:

• d5wx4b1 is new in SCOPe 2.06-stable
  
• d5wx4b1 appears in SCOPe 2.07
  
• d5wx4b1 appears in the current release, SCOPe 2.08