Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (49 species) not a true protein |
Species Marinobacter hydrocarbonoclasticus [TaxId:351348] [333509] (2 PDB entries) |
Domain d5u0mb_: 5u0m B: [333521] automated match to d4knab_ complexed with cit, edo, nad |
PDB Entry: 5u0m (more details), 3.08 Å
SCOPe Domain Sequences for d5u0mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u0mb_ c.82.1.0 (B:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 351348]} ltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrksl aerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertgh tesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgvae ltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpek ilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflarl vevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgll spgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrlv eevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpds lapglnf
Timeline for d5u0mb_: