Lineage for d5mp7b2 (5mp7 B:169-316)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2144416Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2144417Protein automated matches [190891] (32 species)
    not a true protein
  7. 2144560Species Mycobacterium smegmatis [TaxId:246196] [333421] (1 PDB entry)
  8. 2144564Domain d5mp7b2: 5mp7 B:169-316 [333437]
    automated match to d4f8ea2
    complexed with act

Details for d5mp7b2

PDB Entry: 5mp7 (more details), 2.4 Å

PDB Description: crystal structure of phosphoribosylpyrophosphate synthetase from mycobacterium smegmatis
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5mp7b2:

Sequence, based on SEQRES records: (download)

>d5mp7b2 c.61.1.0 (B:169-316) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dedmvvvspdsgrvrvaekwadslggvplafihktrdplvpnqvksnrvvgdvkgktcil
tddmidtggtiagavnllredgakdviiaathgvlsdpapqrlaecgarevivtntlpit
edkrfpqltvlsiapllantiravfeng

Sequence, based on observed residues (ATOM records): (download)

>d5mp7b2 c.61.1.0 (B:169-316) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dedmvvvspdsgrvrvaekwadslggvplafihktrsnrvvgdvkgktciltddmidtgg
tiagavnllredgakdviiaathgvlsdpapqrlaecgarevivtntlpitedkrfpqlt
vlsiapllantiravfeng

SCOPe Domain Coordinates for d5mp7b2:

Click to download the PDB-style file with coordinates for d5mp7b2.
(The format of our PDB-style files is described here.)

Timeline for d5mp7b2: