SCOPe 2.06: Domain d5j5na2: 5j5n A:85-220

Lineage for d5j5na2 (5j5n A:85-220)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Populus trichocarpa [TaxId:3694] [326861] (6 PDB entries)

8. Domain d5j5na2: 5j5n A:85-220 [333108]
   Other proteins in same PDB: d5j5na1, d5j5nb1
   automated match to d5agya2
   complexed with gsh; mutant

Details for d5j5na2

PDB Entry: 5j5n, 2.63 Å

PDB Description: crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione

PDB Compounds: (A:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j5na2:

Sequence; same for both SEQRES and ATOM records:

>d5j5na2 a.45.1.0 (A:85-220) automated matches {Populus trichocarpa [TaxId: 3694]}
llpsdpyqraqsrfwadfvdkkiydlgrkiwtkkgeeqeaakkdfidslklmegelgdkp
yfggetigyvdialvpfyswfyayetignfnieaecpkmiayckrclqketvskaledpq
kvydfvlmlmkkfgie

Timeline for d5j5na2:

• d5j5na2 is new in SCOPe 2.06-stable
  
• d5j5na2 appears in SCOPe 2.07
  
• d5j5na2 appears in the current release, SCOPe 2.08