Lineage for d5tgve_ (5tgv E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386436Domain d5tgve_: 5tgv E: [332811]
    Other proteins in same PDB: d5tgvb_, d5tgvd_, d5tgvf_
    automated match to d4d00c_
    complexed with bma, gal, nag, sia; mutant

Details for d5tgve_

PDB Entry: 5tgv (more details), 2.97 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 3'-sln
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5tgve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgve_ b.19.1.0 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d5tgve_:

Click to download the PDB-style file with coordinates for d5tgve_.
(The format of our PDB-style files is described here.)

Timeline for d5tgve_: