SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tgve_ (5tgv E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (32 species)
    not a true protein
  7. 2040964Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)
  8. 2289510Domain d5tgve_: 5tgv E: [332811]
    Other proteins in same PDB: d5tgvb_, d5tgvd_, d5tgvf_
    automated match to d4d00c_
    complexed with bma, gal, nag, sia; mutant

Details for d5tgve_

PDB Entry: 5tgv (more details), 2.97 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 3'-sln
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5tgve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgve_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d5tgve_:

Click to download the PDB-style file with coordinates for d5tgve_.
(The format of our PDB-style files is described here.)

Timeline for d5tgve_:

  • d5tgve_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06