Lineage for d5uy6a1 (5uy6 A:161-448)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (825 PDB entries)
  8. 2289199Domain d5uy6a1: 5uy6 A:161-448 [332500]
    Other proteins in same PDB: d5uy6a2
    automated match to d2zv2a_
    complexed with 8r4

Details for d5uy6a1

PDB Entry: 5uy6 (more details), 1.7 Å

PDB Description: crystal structure of the human camkk2b
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase kinase 2

SCOPe Domain Sequences for d5uy6a1:

Sequence, based on SEQRES records: (download)

>d5uy6a1 d.144.1.0 (A:161-448) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprrppprgtrpap
ggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevpt
lkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgs
dallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhs
kiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr

Sequence, based on observed residues (ATOM records): (download)

>d5uy6a1 d.144.1.0 (A:161-448) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprrpppgciqprg
pieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevptlkplsedq
arfyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgsdallsntv
gtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqale
fpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr

SCOPe Domain Coordinates for d5uy6a1:

Click to download the PDB-style file with coordinates for d5uy6a1.
(The format of our PDB-style files is described here.)

Timeline for d5uy6a1:

  • d5uy6a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5uy6a2