Lineage for d1egvb_ (1egv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882071Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2882072Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2882073Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2882074Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 2882093Domain d1egvb_: 1egv B: [33215]
    Other proteins in same PDB: d1egva_, d1egvg_, d1egvl_, d1egvm_
    complexed with coy, k, pgo

Details for d1egvb_

PDB Entry: 1egv (more details), 1.75 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsella oxytoca under the illuminated condition.
PDB Compounds: (B:) propanediol dehydratase

SCOPe Domain Sequences for d1egvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egvb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

SCOPe Domain Coordinates for d1egvb_:

Click to download the PDB-style file with coordinates for d1egvb_.
(The format of our PDB-style files is described here.)

Timeline for d1egvb_: