SCOPe 2.07: Domain d5jhwb_: 5jhw B:

Lineage for d5jhwb_ (5jhw B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries)

8. Domain d5jhwb_: 5jhw B: [331665]
   automated match to d3hh2a_
   complexed with flc, po4

Details for d5jhwb_

PDB Entry: 5jhw, 2.35 Å

PDB Description: crystal structure of the gdf11:follistatin 288 complex

PDB Compounds: (B:) Growth/differentiation factor 11

SCOPe Domain Sequences for d5jhwb_:

Sequence; same for both SEQRES and ATOM records:

>d5jhwb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs

Timeline for d5jhwb_:

• d5jhwb_ first appeared in SCOPe 2.06
  
• d5jhwb_ appears in the current release, SCOPe 2.08