SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jhwb_ (5jhw B:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232868Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2232869Protein automated matches [190506] (3 species)
    not a true protein
  7. 2232902Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)
  8. 2288364Domain d5jhwb_: 5jhw B: [331665]
    automated match to d3hh2a_
    complexed with flc, po4

Details for d5jhwb_

PDB Entry: 5jhw (more details), 2.35 Å

PDB Description: crystal structure of the gdf11:follistatin 288 complex
PDB Compounds: (B:) Growth/differentiation factor 11

SCOPe Domain Sequences for d5jhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhwb_ g.17.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs

SCOPe Domain Coordinates for d5jhwb_:

Click to download the PDB-style file with coordinates for d5jhwb_.
(The format of our PDB-style files is described here.)

Timeline for d5jhwb_:

  • d5jhwb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23