Lineage for d5uavb1 (5uav B:1-164)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107829Domain d5uavb1: 5uav B:1-164 [331492]
    Other proteins in same PDB: d5uava2, d5uava3, d5uavb2, d5uavb3, d5uavc2, d5uavc3, d5uavd2, d5uavd3, d5uave2, d5uave3
    automated match to d2izza1
    complexed with ndp, peg, tfb

Details for d5uavb1

PDB Entry: 5uav (more details), 1.85 Å

PDB Description: structure of human pycr-1 complexed with nadph and l-tetrahydrofuroic acid
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uavb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uavb1 c.2.1.0 (B:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d5uavb1:

Click to download the PDB-style file with coordinates for d5uavb1.
(The format of our PDB-style files is described here.)

Timeline for d5uavb1: