SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5us1d_ (5us1 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (37 species)
    not a true protein
  7. 2288090Species Providencia stuartii [TaxId:588] [331391] (1 PDB entry)
  8. 2288179Domain d5us1d_: 5us1 D: [331480]
    Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2
    automated match to d1m44a_
    complexed with 8mm, aco, coa, gol, tar

Details for d5us1d_

PDB Entry: 5us1 (more details), 2.48 Å

PDB Description: crystal structure of aminoglycoside acetyltransferase aac(2')-ia in complex with n2'-acetylgentamicin c1a and coenzyme a
PDB Compounds: (D:) Aminoglycoside 2'-N-acetyltransferase

SCOPe Domain Sequences for d5us1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us1d_ d.108.1.0 (D:) automated matches {Providencia stuartii [TaxId: 588]}
gieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghvai
iqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqk
lyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

SCOPe Domain Coordinates for d5us1d_:

Click to download the PDB-style file with coordinates for d5us1d_.
(The format of our PDB-style files is described here.)

Timeline for d5us1d_:

  • d5us1d_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16