SCOPe 2.07: Domain d5us1j1: 5us1 J:1-178

Lineage for d5us1j1 (5us1 J:1-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries)

8. Domain d5us1j1: 5us1 J:1-178 [331461]
   Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2
   automated match to d1m44a_
   complexed with 8mm, aco, coa, gol, tar

Details for d5us1j1

PDB Entry: 5us1, 2.48 Å

PDB Description: crystal structure of aminoglycoside acetyltransferase aac(2')-ia in complex with n2'-acetylgentamicin c1a and coenzyme a

PDB Compounds: (J:) Aminoglycoside 2'-N-acetyltransferase

SCOPe Domain Sequences for d5us1j1:

Sequence, based on SEQRES records:

>d5us1j1 d.108.1.0 (J:1-178) automated matches {Providencia stuartii [TaxId: 588]}
mgieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghva
iiqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgq
klyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

Sequence, based on observed residues (ATOM records):

>d5us1j1 d.108.1.0 (J:1-178) automated matches {Providencia stuartii [TaxId: 588]}
mgieyrslhtsqltlsekealydlliegfeddfahtlggmhvmafdqqklvghvaiiqrh
maldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqklyhs
vgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

Timeline for d5us1j1:

• d5us1j1 first appeared in SCOPe 2.06
  
• d5us1j1 appears in the current release, SCOPe 2.08