Lineage for d5uaxa2 (5uax A:165-270)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006765Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries)
  8. 2006782Domain d5uaxa2: 5uax A:165-270 [331451]
    Other proteins in same PDB: d5uaxa1, d5uaxa3, d5uaxb1, d5uaxb3, d5uaxc1, d5uaxc3, d5uaxd1, d5uaxd3, d5uaxe1
    automated match to d2izzc2
    complexed with cl

Details for d5uaxa2

PDB Entry: 5uax (more details), 1.85 Å

PDB Description: structure of apo human pycr-1 crystallized in space group c2
PDB Compounds: (A:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uaxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaxa2 a.100.1.0 (A:165-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqs

SCOPe Domain Coordinates for d5uaxa2:

Click to download the PDB-style file with coordinates for d5uaxa2.
(The format of our PDB-style files is described here.)

Timeline for d5uaxa2: