SCOPe 2.07: Domain d4lhjb_: 4lhj B:

Lineage for d4lhjb_ (4lhj B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d4lhjb_: 4lhj B: [331052]
   Other proteins in same PDB: d4lhja_
   automated match to d4p2cg_
   complexed with cl

Details for d4lhjb_

PDB Entry: 4lhj, 1.8 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh5)

PDB Compounds: (B:) Camelid antibody

SCOPe Domain Sequences for d4lhjb_:

Sequence; same for both SEQRES and ATOM records:

>d4lhjb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslrlscaasgsivnfetmgwyrqapgkerelvatitnegssnya
dsvkgrftisgdnakntvslqmnslkpedtavyycsatfgsrwpyahsdhwgqgtqvtvs

Timeline for d4lhjb_:

• d4lhjb_ first appeared in SCOPe 2.06
  
• d4lhjb_ appears in the current release, SCOPe 2.08