SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lhjb_ (4lhj B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020506Species Vicugna pacos [TaxId:30538] [189756] (23 PDB entries)
  8. 2287751Domain d4lhjb_: 4lhj B: [331052]
    automated match to d4p2cg_
    complexed with cl

Details for d4lhjb_

PDB Entry: 4lhj (more details), 1.8 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh5)
PDB Compounds: (B:) Camelid antibody

SCOPe Domain Sequences for d4lhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhjb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslrlscaasgsivnfetmgwyrqapgkerelvatitnegssnya
dsvkgrftisgdnakntvslqmnslkpedtavyycsatfgsrwpyahsdhwgqgtqvtvs

SCOPe Domain Coordinates for d4lhjb_:

Click to download the PDB-style file with coordinates for d4lhjb_.
(The format of our PDB-style files is described here.)

Timeline for d4lhjb_:

  • d4lhjb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16