SCOPe 2.07: Domain d5g2zb_: 5g2z B:

Lineage for d5g2zb_ (5g2z B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (14 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)

8. Domain d5g2zb_: 5g2z B: [331037]
   automated match to d4aj8a_
   mutant

Details for d5g2zb_

PDB Entry: 5g2z, 1.88 Å

PDB Description: crystallographic structure of mutant w31a of thioredoxin from litopenaeus vannamei

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5g2zb_:

Sequence; same for both SEQRES and ATOM records:

>d5g2zb_ c.47.1.1 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatacgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

Timeline for d5g2zb_:

• d5g2zb_ first appeared in SCOPe 2.06
  
• d5g2zb_ appears in the current release, SCOPe 2.08