Lineage for d5g2zb_ (5g2z B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117275Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)
  8. 2287736Domain d5g2zb_: 5g2z B: [331037]
    automated match to d4aj8a_
    mutant

Details for d5g2zb_

PDB Entry: 5g2z (more details), 1.88 Å

PDB Description: crystallographic structure of mutant w31a of thioredoxin from litopenaeus vannamei
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5g2zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g2zb_ c.47.1.1 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatacgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d5g2zb_:

Click to download the PDB-style file with coordinates for d5g2zb_.
(The format of our PDB-style files is described here.)

Timeline for d5g2zb_:

  • d5g2zb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from other chains:
(mouse over for more information)
d5g2za_