Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries) |
Domain d5ecmf1: 5ecm F:4-83 [330657] Other proteins in same PDB: d5ecmb2, d5ecmc2, d5ecme2, d5ecmf2 automated match to d3fhsa3 complexed with gsh, jaa, leu |
PDB Entry: 5ecm (more details), 1.6 Å
SCOPe Domain Sequences for d5ecmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecmf1 c.47.1.0 (F:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp vceslnvvqyvdeawpeknp
Timeline for d5ecmf1: