SCOPe 2.07: Domain d5tihl1: 5tih L:1-107

Lineage for d5tihl1 (5tih L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d5tihl1: 5tih L:1-107 [330518]
   Other proteins in same PDB: d5tihl2
   automated match to d1kegl1
   complexed with act

Details for d5tihl1

PDB Entry: 5tih, 2.44 Å

PDB Description: structural basis for inhibition of erythrocyte invasion by antibodies to plasmodium falciparum protein cyrpa

PDB Compounds: (L:) CyRPA antibody Fab Light Chain

SCOPe Domain Sequences for d5tihl1:

Sequence; same for both SEQRES and ATOM records:

>d5tihl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeisgylswlqrkpdgtikrliytastvdsgvpn
rfsgsrsgsdysltisslesedfadyyclqydtypwtfgggtkleik

Timeline for d5tihl1:

• d5tihl1 first appeared in SCOPe 2.06
  
• d5tihl1 appears in the current release, SCOPe 2.08