SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tihl1 (5tih L:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2287217Domain d5tihl1: 5tih L:1-107 [330518]
    Other proteins in same PDB: d5tihl2
    automated match to d1kegl1
    complexed with act

Details for d5tihl1

PDB Entry: 5tih (more details), 2.44 Å

PDB Description: structural basis for inhibition of erythrocyte invasion by antibodies to plasmodium falciparum protein cyrpa
PDB Compounds: (L:) CyRPA antibody Fab Light Chain

SCOPe Domain Sequences for d5tihl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tihl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeisgylswlqrkpdgtikrliytastvdsgvpn
rfsgsrsgsdysltisslesedfadyyclqydtypwtfgggtkleik

SCOPe Domain Coordinates for d5tihl1:

Click to download the PDB-style file with coordinates for d5tihl1.
(The format of our PDB-style files is described here.)

Timeline for d5tihl1:

  • d5tihl1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02