Lineage for d5tihl1 (5tih L:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (569 PDB entries)
  8. 2287217Domain d5tihl1: 5tih L:1-107 [330518]
    Other proteins in same PDB: d5tihl2
    automated match to d1kegl1
    complexed with act

Details for d5tihl1

PDB Entry: 5tih (more details), 2.44 Å

PDB Description: structural basis for inhibition of erythrocyte invasion by antibodies to plasmodium falciparum protein cyrpa
PDB Compounds: (L:) CyRPA antibody Fab Light Chain

SCOPe Domain Sequences for d5tihl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tihl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeisgylswlqrkpdgtikrliytastvdsgvpn
rfsgsrsgsdysltisslesedfadyyclqydtypwtfgggtkleik

SCOPe Domain Coordinates for d5tihl1:

Click to download the PDB-style file with coordinates for d5tihl1.
(The format of our PDB-style files is described here.)

Timeline for d5tihl1:

  • d5tihl1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02