Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [329969] (1 PDB entry) |
Domain d5ft3b1: 5ft3 B:1-86 [329972] Other proteins in same PDB: d5ft3a2, d5ft3b2 automated match to d3zmkb1 complexed with gsh |
PDB Entry: 5ft3 (more details), 1.43 Å
SCOPe Domain Sequences for d5ft3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ft3b1 c.47.1.0 (B:1-86) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} mtklilytlhvsppcravelcakalgleleqktvnlltkehltpefmkmnpqhtvpvldd ngtivceshaimiylvskygkddsly
Timeline for d5ft3b1: