SCOPe 2.07: Domain d5ft3b1: 5ft3 B:1-86

Lineage for d5ft3b1 (5ft3 B:1-86)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [329969] (1 PDB entry)

8. Domain d5ft3b1: 5ft3 B:1-86 [329972]
   Other proteins in same PDB: d5ft3a2, d5ft3b2
   automated match to d3zmkb1
   complexed with gsh

Details for d5ft3b1

PDB Entry: 5ft3, 1.43 Å

PDB Description: aedes aegypti gste2

PDB Compounds: (B:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3b1:

Sequence; same for both SEQRES and ATOM records:

>d5ft3b1 c.47.1.0 (B:1-86) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
mtklilytlhvsppcravelcakalgleleqktvnlltkehltpefmkmnpqhtvpvldd
ngtivceshaimiylvskygkddsly

Timeline for d5ft3b1:

• d5ft3b1 first appeared in SCOPe 2.06
  
• d5ft3b1 appears in the current release, SCOPe 2.08