Lineage for d5ft3b1 (5ft3 B:1-86)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (164 species)
    not a true protein
  7. 2286668Species Aedes aegypti [TaxId:7159] [329969] (1 PDB entry)
  8. 2286671Domain d5ft3b1: 5ft3 B:1-86 [329972]
    Other proteins in same PDB: d5ft3a2, d5ft3b2
    automated match to d3zmkb1
    complexed with gsh

Details for d5ft3b1

PDB Entry: 5ft3 (more details), 1.43 Å

PDB Description: aedes aegypti gste2
PDB Compounds: (B:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft3b1 c.47.1.0 (B:1-86) automated matches {Aedes aegypti [TaxId: 7159]}
mtklilytlhvsppcravelcakalgleleqktvnlltkehltpefmkmnpqhtvpvldd
ngtivceshaimiylvskygkddsly

SCOPe Domain Coordinates for d5ft3b1:

Click to download the PDB-style file with coordinates for d5ft3b1.
(The format of our PDB-style files is described here.)

Timeline for d5ft3b1:

  • d5ft3b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ft3b2