SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ft3b1 (5ft3 B:1-86)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (160 species)
    not a true protein
  7. 2286668Species Aedes aegypti [TaxId:7159] [329969] (1 PDB entry)
  8. 2286671Domain d5ft3b1: 5ft3 B:1-86 [329972]
    Other proteins in same PDB: d5ft3a2, d5ft3b2
    automated match to d3zmkb1
    complexed with gsh

Details for d5ft3b1

PDB Entry: 5ft3 (more details), 1.43 Å

PDB Description: aedes aegypti gste2
PDB Compounds: (B:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft3b1 c.47.1.0 (B:1-86) automated matches {Aedes aegypti [TaxId: 7159]}
mtklilytlhvsppcravelcakalgleleqktvnlltkehltpefmkmnpqhtvpvldd
ngtivceshaimiylvskygkddsly

SCOPe Domain Coordinates for d5ft3b1:

Click to download the PDB-style file with coordinates for d5ft3b1.
(The format of our PDB-style files is described here.)

Timeline for d5ft3b1:

  • d5ft3b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ft3b2