Lineage for d1f3ba2 (1f3b A:1-79)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168430Protein Class alpha GST [81360] (8 species)
  7. 1168507Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries)
  8. 1168508Domain d1f3ba2: 1f3b A:1-79 [32993]
    Other proteins in same PDB: d1f3ba1, d1f3bb1
    complexed with gbx

Details for d1f3ba2

PDB Entry: 1f3b (more details), 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
PDB Compounds: (A:) glutathione s-transferase ya chain

SCOPe Domain Sequences for d1f3ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ba2 c.47.1.5 (A:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

SCOPe Domain Coordinates for d1f3ba2:

Click to download the PDB-style file with coordinates for d1f3ba2.
(The format of our PDB-style files is described here.)

Timeline for d1f3ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3ba1