Lineage for d1gumf2 (1gum F:4-80)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833733Protein Class alpha GST [81360] (8 species)
  7. 833753Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
    Uniprot P08263
  8. 833805Domain d1gumf2: 1gum F:4-80 [32982]
    Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1

Details for d1gumf2

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands
PDB Compounds: (F:) protein (glutathione transferase a4-4)

SCOP Domain Sequences for d1gumf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gumf2 c.47.1.5 (F:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOP Domain Coordinates for d1gumf2:

Click to download the PDB-style file with coordinates for d1gumf2.
(The format of our PDB-style files is described here.)

Timeline for d1gumf2: