Lineage for d5u2vg1 (5u2v G:1-110)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033346Domain d5u2vg1: 5u2v G:1-110 [329620]
    Other proteins in same PDB: d5u2va1, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc3, d5u2vd_, d5u2ve2, d5u2vg2
    automated match to d2f54d1
    complexed with 7wq, gol, pro

Details for d5u2vg1

PDB Entry: 5u2v (more details), 2.2 Å

PDB Description: structure of human mr1-hmb in complex with human mait a-f7 tcr
PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u2vg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2vg1 b.1.1.0 (G:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d5u2vg1:

Click to download the PDB-style file with coordinates for d5u2vg1.
(The format of our PDB-style files is described here.)

Timeline for d5u2vg1: