Lineage for d5gyre_ (5gyr E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2313134Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2313135Protein Cytochrome c' [47180] (9 species)
  7. 2313152Species Allochromatium vinosum [TaxId:572477] [329419] (1 PDB entry)
  8. 2313155Domain d5gyre_: 5gyr E: [329525]
    automated match to d1bbha_
    complexed with hem

Details for d5gyre_

PDB Entry: 5gyr (more details), 1.6 Å

PDB Description: tetrameric allochromatium vinosum cytochrome c'
PDB Compounds: (E:) cytochrome c'

SCOPe Domain Sequences for d5gyre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gyre_ a.24.3.2 (E:) Cytochrome c' {Allochromatium vinosum [TaxId: 572477]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak

SCOPe Domain Coordinates for d5gyre_:

Click to download the PDB-style file with coordinates for d5gyre_.
(The format of our PDB-style files is described here.)

Timeline for d5gyre_: