SCOPe 2.08: Domain d5m19b2: 5m19 B:139-327

Lineage for d5m19b2 (5m19 B:139-327)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d5m19b2: 5m19 B:139-327 [329483]
   Other proteins in same PDB: d5m19a1, d5m19a3, d5m19b1, d5m19b3
   automated match to d1vqqa2
   complexed with cd, mur
   has additional subdomain(s) that are not in the common domain

Details for d5m19b2

PDB Entry: 5m19, 2 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of oxacillin ligand

PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m19b2:

Sequence; same for both SEQRES and ATOM records:

>d5m19b2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d5m19b2:

• d5m19b2 first appeared in SCOPe 2.06
  
• d5m19b2 appears in SCOPe 2.07