Lineage for d5ue6f1 (5ue6 F:53-203)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382262Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)
  8. 2382273Domain d5ue6f1: 5ue6 F:53-203 [329382]
    Other proteins in same PDB: d5ue6a2, d5ue6b2, d5ue6c2, d5ue6d2, d5ue6e2, d5ue6f2, d5ue6g2, d5ue6h2, d5ue6i2
    automated match to d1kbva1
    complexed with cu, na

Details for d5ue6f1

PDB Entry: 5ue6 (more details), 2.35 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group i4122
PDB Compounds: (F:) nitrite reductase

SCOPe Domain Sequences for d5ue6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue6f1 b.6.1.0 (F:53-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOPe Domain Coordinates for d5ue6f1:

Click to download the PDB-style file with coordinates for d5ue6f1.
(The format of our PDB-style files is described here.)

Timeline for d5ue6f1: