Lineage for d5ue6i2 (5ue6 I:204-363)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381772Protein automated matches [226877] (4 species)
    not a true protein
  7. 2381859Species Neisseria gonorrhoeae [TaxId:242231] [329297] (2 PDB entries)
  8. 2381871Domain d5ue6i2: 5ue6 I:204-363 [329343]
    Other proteins in same PDB: d5ue6a1, d5ue6b1, d5ue6c1, d5ue6d1, d5ue6e1, d5ue6f1, d5ue6g1, d5ue6h1, d5ue6i1
    automated match to d1kbva2
    complexed with cu, na

Details for d5ue6i2

PDB Entry: 5ue6 (more details), 2.35 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group i4122
PDB Compounds: (I:) nitrite reductase

SCOPe Domain Sequences for d5ue6i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue6i2 b.6.1.3 (I:204-363) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeimtqklsdtay

SCOPe Domain Coordinates for d5ue6i2:

Click to download the PDB-style file with coordinates for d5ue6i2.
(The format of our PDB-style files is described here.)

Timeline for d5ue6i2: